PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR04G19330.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family MYB
Protein Properties Length: 321aa    MW: 35406.9 Da    PI: 6.2325
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR04G19330.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-141564148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd  lv+ +k+ Gg+  +W+  ++  g++R++k+c++rw +yl
  LPERR04G19330.1 15 KGPWTEEEDRTLVEHIKKQGGHvgSWRGLPKAAGLNRCGKSCRLRWTNYL 64
                     79**********************************************97 PP

2Myb_DNA-binding52.11.5e-1670114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ eE+ l++++++ lG++ W+tIa  +  gRt++++k++w+++
  LPERR04G19330.1  70 RGNFSDEEEHLIIRLHASLGNK-WSTIATQLE-GRTDNEIKNYWNTH 114
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.251064IPR017930Myb domain
SuperFamilySSF466896.36E-2712111IPR009057Homeodomain-like
SMARTSM007173.2E-101466IPR001005SANT/Myb domain
PfamPF002494.7E-131564IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-211671IPR009057Homeodomain-like
CDDcd001671.17E-81764No hitNo description
PROSITE profilePS5129426.44465119IPR017930Myb domain
SMARTSM007176.7E-1469117IPR001005SANT/Myb domain
PfamPF002499.9E-1570114IPR001005SANT/Myb domain
CDDcd001672.69E-1072115No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2672119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRSPCCCHD TGVKKGPWTE EEDRTLVEHI KKQGGHVGSW RGLPKAAGLN RCGKSCRLRW  60
TNYLRPDIKR GNFSDEEEHL IIRLHASLGN KWSTIATQLE GRTDNEIKNY WNTHIKKKLM  120
RMGIDPVTHQ RLPPELLAVD GAGGLASPLL SPTTAALQPL LSAVSSLGSL DTALREVQLL  180
QHLLNAISSN NAASLMANLA ATNSTGNYQY QMNALVHAAN YQLPGYLRDV PSFAGQDMDQ  240
QQSCDNSAPV IRSSSAEPVD QCCNNAALVT ETYPQEVTAS VDWQMQEFPN LEPLDQLPNL  300
CSLESDLDPF WKGVLDSSFR L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25151197108B-MYB
1h8a_C2e-251511927128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2432711e-170AK243271.1 Oryza sativa Japonica Group cDNA, clone: J100049K04, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635814.11e-166PREDICTED: transcription factor MYB34
TrEMBLA0A0D9W8U50.0A0A0D9W8U5_9ORYZ; Uncharacterized protein
STRINGBGIOSGA014443-PA1e-166(Oryza sativa Indica Group)
STRINGLOC_Os04g50680.11e-166(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62652955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-68myb domain protein 9